Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees
Methanobacterium thermoautotrophicum
>MTH1896 hypothetical protein MTH1896 
MTFKDDTMKRKYSLVAVGGTFDRFHKGHRRLLDEAFRVGETVMIGVTSDEFAAAKGEGIEPCSVRMKNLEEYLRDKDADY
HVMRLDDPYGTTVTDEAFEAIVVSRETEPVAREINAIRRNRGFRELDIITIDMVNADDGIPISSTRIRRGEIDPMGHIIK
RIRGALRRRRE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 15679878 Gene name: - COG: R COG1019 Predicted nucleotidyltransferase Taxon: 187420 Lineage: Archaea: Euryarchaeota: Methanobacteria: Methanobacteriales: Methanobacteriaceae: Methanothermobacter: Methanothermobacter thermautotrophicus: Methanothermobacter thermautotrophicus str. Delta H
__________