Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees
Methanobacterium thermoautotrophicum
>MTH432 hypothetical protein MTH432 
MRSAVLYSGGKDSTMALYHALQESEVEFLVSVISDNPESHMYHVPNIHLTALLAEAVGIPLIESRTAGVEEEEVEDLAGT
LKTLRERGVEAVYSGALYSEYQKSRIDSICRRLGLRSVAPLWHRDPLDYMEEIVDLGFRVMVTAVAAEGLDESWLGRIVD
RKMIDELADLSERYGINPAFEGGEAESLVLDGPIFKKRLEILEYEKKWFFDNGFLDIKRAVLVDKD

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 15678460 Gene name: - COG: R COG2102 Predicted ATPases of PP-loop superfamily Taxon: 187420 Lineage: Archaea: Euryarchaeota: Methanobacteria: Methanobacteriales: Methanobacteriaceae: Methanothermobacter: Methanothermobacter thermautotrophicus: Methanothermobacter thermautotrophicus str. Delta H
__________