Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Archaeoglobus fulgidus
>AF2209 hypothetical protein AF2209 
MEQIFVYFTGTAGSGKTYMTKALADWFDLKKLDYLTVNLDPGADFLPYSADIDVREWFTLEDIMGRYNVGPNGAQIIGAD
LVSTLIDDIRDEIQLSSSEYVLIDTPGQLELFTLRESSRVLVNALNPERSVMVYLFDPVVSKTPSGFLSMLFMASSAVFR
LEIPQVLVLSKSDILSERELERIVEWSEDPETLYDSLNLERKTLNLELFLLLKEAGLFRPLIPASALTGYGMEDIYDAIQ
EIFYGGDDLERILF

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 11499791 Gene name: - COG: R COG1100 GTPase SAR1 and related small G proteins Taxon: 224325 Lineage: Archaea: Euryarchaeota: Archaeoglobi: Archaeoglobales: Archaeoglobaceae: Archaeoglobus: Archaeoglobus fulgidus: Archaeoglobus fulgidus DSM 4304
__________