Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Pyrococcus abyssi
>PAB7289 rpl34E LSU ribosomal protein L34E
MKPMYRSRSWRRKYVRTPGGRVVIHFERRKPKIAHCAICGRPLNGIPRGRPVEMRKLPKTKKRPERPYPHLCPKCMRRVM
KEQVRAQIMKG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
See this orf in P. abyssi Data Base
__________ GenBank id: 33356749 Gene name: rpL34E COG: J COG2174 Ribosomal protein L34E Taxon: 272844 Lineage: Archaea: Euryarchaeota: Thermococci: Thermococcales: Thermococcaceae: Pyrococcus: Pyrococcus abyssi: Pyrococcus abyssi GE5
__________