ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactI0329    suspect: LH   C     KOG4075  Energy production and conversion                               Cytochrome c oxidase, subunit IV/COX5b

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactI0329  116612  117034 141  
         (141 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YIL111w [C] KOG4075 Cytochrome c oxidase subunit IV/COX5b              50   1e-06

>YIL111w [C] KOG4075 Cytochrome c oxidase subunit IV/COX5b
          Length = 151

 Score = 50.1 bits (118), Expect = 1e-06
 Identities = 28/81 (34%), Positives = 41/81 (50%), Gaps = 11/81 (13%)

Query: 40  WLHMNRDTREEINEYLDWRMEEPWKNLDLNDKRCAYYIAYGEWGPRAKKGSKEDQIEMNG 99
           W +M    ++EI + L  R + PWK L+  + + A+YI+YGEWGPR     K D      
Sbjct: 35  WENMPNLEQKEIADNLTERQKLPWKTLNNEEIKAAWYISYGEWGPRRPVHGKGD------ 88

Query: 100 PELILKAMFSLTLFLALGFAF 120
                 A  +  +FL LG +F
Sbjct: 89  -----VAFITKGVFLGLGISF 104


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.319    0.137    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,885,077
Number of Sequences: 60738
Number of extensions: 358881
Number of successful extensions: 772
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 770
Number of HSP's gapped (non-prelim): 2
length of query: 141
length of database: 30,389,216
effective HSP length: 95
effective length of query: 46
effective length of database: 24,619,106
effective search space: 1132478876
effective search space used: 1132478876
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)