ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactI1001.1 suspect: LH R KOG1824 General function prediction only TATA-binding protein-interacting protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactI1001.1 338139 337894 -82  
         (82 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value 7297672 [R] KOG1824 TATA-binding protein-interacting protein 28 2.9 Hs22040856 [U] KOG0864 Ran-binding protein RANBP1 and related Ra... 26 8.5 >7297672 [R] KOG1824 TATA-binding protein-interacting protein Length = 1248 Score = 27.7 bits (60), Expect = 2.9 Identities = 12/31 (38%), Positives = 16/31 (50%) Query: 49 PSGIEPLIPALLARCLNQLGQGTNLDVEEED 79 P I P IP +L CLN + N + E +D Sbjct: 285 PDAINPHIPMILELCLNYITYDPNYNYETDD 315 >Hs22040856 [U] KOG0864 Ran-binding protein RANBP1 and related RanBD domain proteins Length = 738 Score = 26.2 bits (56), Expect = 8.5 Identities = 8/31 (25%), Positives = 20/31 (63%) Query: 51 GIEPLIPALLARCLNQLGQGTNLDVEEEDCV 81 G++P + A+CL ++G+G N ++++ + Sbjct: 404 GLQPALLVHWAKCLQKMGRGLNSSYDQQEYI 434 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.312 0.129 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,666,122 Number of Sequences: 60738 Number of extensions: 81715 Number of successful extensions: 127 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 125 Number of HSP's gapped (non-prelim): 2 length of query: 82 length of database: 30,389,216 effective HSP length: 58 effective length of query: 24 effective length of database: 26,866,412 effective search space: 644793888 effective search space used: 644793888 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)