ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactI1196 good A KOG3454 RNA processing and modification U1 snRNP-specific protein C

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactI1196 408150 407584 -189 
         (189 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YLR298c [A] KOG3454 U1 snRNP-specific protein C 128 4e-30 SPBP35G2.09 [A] KOG3454 U1 snRNP-specific protein C 55 7e-08 Hs4507127 [A] KOG3454 U1 snRNP-specific protein C 54 2e-07 Hs22052125 [A] KOG3454 U1 snRNP-specific protein C 52 5e-07 7300460 [A] KOG3454 U1 snRNP-specific protein C 49 5e-06 >YLR298c [A] KOG3454 U1 snRNP-specific protein C Length = 231 Score = 128 bits (322), Expect = 4e-30 Identities = 79/210 (37%), Positives = 108/210 (50%), Gaps = 23/210 (10%) Query: 1 MVRFYCWYCKSYLTHDTASVRKSHLLGKNHIRLVADYYRNISL-IEESKKLKRTKNRKPH 59 M R+YC YC SYLTHDT SVRKSHL+GKNH+R+ ADYYRN + I KR K Sbjct: 1 MTRYYCEYCHSYLTHDTLSVRKSHLVGKNHLRITADYYRNKARDIINKHNHKRRHIGKRG 60 Query: 60 EKEVTESRNAPRCVIHCPTNRRKR----MMKITKNKDTLDDLDVLDAIYKGSPGYERIFR 115 KE S + C +N+ KR + K+ + + +D L +Y GSPGY ++F Sbjct: 61 RKERENSSQNETLKVTCLSNKEKRHIMHVKKMNQKELAQTSIDTLKLLYDGSPGYSKVFV 120 Query: 116 PENRIDIGHLLKVSKQPQRGNV------------NRNSVAK----PTLNESTSVLPPPRT 159 NR DIG L+K SK PQR N +R+ + P LN + PP Sbjct: 121 DANRFDIGDLVKASKLPQRANEKSAHHSFKQTSRSRDETCESNPFPRLNNPKKLEPPKIL 180 Query: 160 LAWNNTY--SMKFHDPSLLQKSINHTVKQL 187 W+NT + F+ +LQ +I + K++ Sbjct: 181 SQWSNTIPKTSIFYSVDILQTTIKESKKRM 210 >SPBP35G2.09 [A] KOG3454 U1 snRNP-specific protein C Length = 182 Score = 54.7 bits (130), Expect = 7e-08 Identities = 24/51 (47%), Positives = 35/51 (68%) Query: 1 MVRFYCWYCKSYLTHDTASVRKSHLLGKNHIRLVADYYRNISLIEESKKLK 51 M R+ C YC+ +LTHD+ SVRK+H G+ HI+ V DYY ++ E K+L+ Sbjct: 1 MPRYLCDYCQVWLTHDSQSVRKAHNAGRAHIQNVQDYYTKVAQEEAQKQLE 51 >Hs4507127 [A] KOG3454 U1 snRNP-specific protein C Length = 159 Score = 53.5 bits (127), Expect = 2e-07 Identities = 22/39 (56%), Positives = 28/39 (71%) Query: 1 MVRFYCWYCKSYLTHDTASVRKSHLLGKNHIRLVADYYR 39 M +FYC YC +YLTHD+ SVRK+H G+ H V DYY+ Sbjct: 1 MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQ 39 >Hs22052125 [A] KOG3454 U1 snRNP-specific protein C Length = 155 Score = 52.0 bits (123), Expect = 5e-07 Identities = 21/39 (53%), Positives = 27/39 (68%) Query: 1 MVRFYCWYCKSYLTHDTASVRKSHLLGKNHIRLVADYYR 39 M +FYC YC +YLTHD+ VRK+H G+ H V DYY+ Sbjct: 1 MPKFYCDYCNTYLTHDSPPVRKTHCSGRKHKENVKDYYQ 39 >7300460 [A] KOG3454 U1 snRNP-specific protein C Length = 145 Score = 48.5 bits (114), Expect = 5e-06 Identities = 20/39 (51%), Positives = 27/39 (68%) Query: 1 MVRFYCWYCKSYLTHDTASVRKSHLLGKNHIRLVADYYR 39 M ++YC YC +YLTHD+ SVRK+H G+ H V YY+ Sbjct: 1 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQ 39 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.318 0.133 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,161,116 Number of Sequences: 60738 Number of extensions: 507024 Number of successful extensions: 1581 Number of sequences better than 1.0e-05: 5 Number of HSP's better than 0.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1574 Number of HSP's gapped (non-prelim): 5 length of query: 189 length of database: 30,389,216 effective HSP length: 100 effective length of query: 89 effective length of database: 24,315,416 effective search space: 2164072024 effective search space used: 2164072024 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)