ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactI1791 suspect: LH C KOG4116 Energy production and conversion Ubiquinol cytochrome c reductase, subunit QCR8

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactI1791 611055  611336 94   
         (94 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YJL166w [C] KOG4116 Ubiquinol cytochrome c reductase subunit QCR8 152 8e-38 SPAC1782.07 [C] KOG4116 Ubiquinol cytochrome c reductase subunit... 80 4e-16 >YJL166w [C] KOG4116 Ubiquinol cytochrome c reductase subunit QCR8 Length = 94 Score = 152 bits (384), Expect = 8e-38 Identities = 66/94 (70%), Positives = 75/94 (79%) Query: 1 MGGPHAKAYMGWWGSIGSPAQKGITTYTVSPYAQKPLNNIFHNAVFNTFRRVKSQILYMA 60 MG P K YMGWWG +G P QKGIT+Y VSPYAQKPL IFHNAVFN+FRR KSQ LY+ Sbjct: 1 MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVL 60 Query: 61 LPAALYWAWWVNCRDYNAYLYTKAGREELERVNV 94 +PA +YW WW N +YN +LY+KAGREELERVNV Sbjct: 61 IPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV 94 >SPAC1782.07 [C] KOG4116 Ubiquinol cytochrome c reductase subunit QCR8 Length = 92 Score = 80.5 bits (197), Expect = 4e-16 Identities = 37/91 (40%), Positives = 58/91 (63%), Gaps = 4/91 (4%) Query: 2 GGPHAKAYMGWWGSIGSPAQKGITTYTVSPYAQKPLNNIFHNAVFNTFRRVKSQILYMAL 61 G K Y+GWWG +G P QKGI TY++SP+ Q+P+ F + N FRRV ++ LY+A+ Sbjct: 3 GAAGGKTYLGWWGHLGGPKQKGIITYSLSPFQQRPMAGFFKTSTQNMFRRVMTEGLYVAI 62 Query: 62 PAALYWAWWVNC--RDYNAYLYTKAGREELE 90 P + A+++ C ++ N +L +K GR +E Sbjct: 63 PFGI--AYYIYCWGKERNEFLNSKHGRHLVE 91 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.322 0.135 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,933,585 Number of Sequences: 60738 Number of extensions: 213433 Number of successful extensions: 570 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 568 Number of HSP's gapped (non-prelim): 2 length of query: 94 length of database: 30,389,216 effective HSP length: 70 effective length of query: 24 effective length of database: 26,137,556 effective search space: 627301344 effective search space used: 627301344 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits)