ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactI1895 good J KOG1714 Translation, ribosomal structure and biogenesis 60s ribosomal protein L18

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactI1895 649488 649288 -67  
         (67 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YOL120c [J] KOG1714 60s ribosomal protein L18 79 1e-15 YNL301c [J] KOG1714 60s ribosomal protein L18 79 1e-15 SPBC11C11.07 [J] KOG1714 60s ribosomal protein L18 51 3e-07 At5g27850 [J] KOG1714 60s ribosomal protein L18 50 4e-07 CE16650 [J] KOG1714 60s ribosomal protein L18 49 1e-06 At3g05590 [J] KOG1714 60s ribosomal protein L18 48 3e-06 >YOL120c [J] KOG1714 60s ribosomal protein L18 Length = 186 Score = 79.0 bits (193), Expect = 1e-15 Identities = 37/41 (90%), Positives = 38/41 (92%) Query: 1 MGIDHTSKQHKRSSHRTAPKSDNVYLKLLVKLYAFLARMSD 41 MGIDHTSKQHKRS HRTAPKSDNVYLKLLVKLY FLAR +D Sbjct: 1 MGIDHTSKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTD 41 >YNL301c [J] KOG1714 60s ribosomal protein L18 Length = 186 Score = 79.0 bits (193), Expect = 1e-15 Identities = 37/41 (90%), Positives = 38/41 (92%) Query: 1 MGIDHTSKQHKRSSHRTAPKSDNVYLKLLVKLYAFLARMSD 41 MGIDHTSKQHKRS HRTAPKSDNVYLKLLVKLY FLAR +D Sbjct: 1 MGIDHTSKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTD 41 >SPBC11C11.07 [J] KOG1714 60s ribosomal protein L18 Length = 187 Score = 51.2 bits (121), Expect = 3e-07 Identities = 27/56 (48%), Positives = 37/56 (65%), Gaps = 1/56 (1%) Query: 1 MGIDHTSKQHKRSSHRTAPKSDNVYLKLLVKLYAFLARMSDNYISNDGIRREKEKK 56 MGID + H + S R+ P S+NVYLKLLVKLY FLAR +D+ + ++R + K Sbjct: 1 MGID-IERHHVKKSQRSKPASENVYLKLLVKLYRFLARRTDSRFNKAILKRLFQSK 55 >At5g27850 [J] KOG1714 60s ribosomal protein L18 Length = 187 Score = 50.4 bits (119), Expect = 4e-07 Identities = 25/42 (59%), Positives = 31/42 (73%) Query: 1 MGIDHTSKQHKRSSHRTAPKSDNVYLKLLVKLYAFLARMSDN 42 MGID + + + RTAPKSD+VYLKLLVKLY FL R S++ Sbjct: 1 MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSNS 42 >CE16650 [J] KOG1714 60s ribosomal protein L18 Length = 188 Score = 48.9 bits (115), Expect = 1e-06 Identities = 26/38 (68%), Positives = 29/38 (75%), Gaps = 1/38 (2%) Query: 1 MGIDHTSKQHKRSSHRTAPKSDNVYLKLLVKLYAFLAR 38 MGID K H R + RTAPKS+N YL+LL KLYAFLAR Sbjct: 1 MGIDINHK-HDRVARRTAPKSENPYLRLLSKLYAFLAR 37 >At3g05590 [J] KOG1714 60s ribosomal protein L18 Length = 187 Score = 47.8 bits (112), Expect = 3e-06 Identities = 24/51 (47%), Positives = 34/51 (66%) Query: 1 MGIDHTSKQHKRSSHRTAPKSDNVYLKLLVKLYAFLARMSDNYISNDGIRR 51 MGID + + + RTAPKSD+VYLKL VKLY FL R +++ + ++R Sbjct: 1 MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKFNGVILKR 51 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.316 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,925,919 Number of Sequences: 60738 Number of extensions: 123559 Number of successful extensions: 299 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 294 Number of HSP's gapped (non-prelim): 6 length of query: 67 length of database: 30,389,216 effective HSP length: 43 effective length of query: 24 effective length of database: 27,777,482 effective search space: 666659568 effective search space used: 666659568 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)