ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactI1977 suspect: LH L KOG0011 Replication, recombination and repair Nucleotide excision repair factor NEF2, RAD23 component

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactI1977 675804 675172 -211 
         (211 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YOL111c [L] KOG0011 Nucleotide excision repair factor NEF2 RAD23... 130 1e-30 >YOL111c [L] KOG0011 Nucleotide excision repair factor NEF2 RAD23 component Length = 212 Score = 130 bits (328), Expect = 1e-30 Identities = 84/219 (38%), Positives = 115/219 (52%), Gaps = 25/219 (11%) Query: 3 ELDFVGKFLSLAALNEPKLASNYRKPLHEVTNLGVSLPPLRYKYDPXXX--------XXX 54 E +FV KFL+LA L EPKL +Y KPL +VTNLGV LP L+YKY Sbjct: 9 EHEFVSKFLTLATLTEPKLPKSYTKPLKDVTNLGVPLPTLKYKYKQNRAKKLKLHQDQQG 68 Query: 55 XXXXVVEVTIKSIKAPKFVHSKSFESTDTVGQIKEFLVETEPEIYTTGQIKLLLKGKVLH 114 V +T+K I+APKF F +DT+ QIK+ L+ E + + +IKLLLKGKVLH Sbjct: 69 QDNAAVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHIS-EIKLLLKGKVLH 127 Query: 115 DTQLVSDLNQDKISLVAMVSKAEKPVETAPLPKPAQEPEPELELMDVDMEDPQLDLSSQT 174 D +SDL V+ A + P P EPE E + P + Sbjct: 128 DNLFLSDLK---------VTPANSTITVMIKPNPTISKEPEAE-KSTNSPAP----APPQ 173 Query: 175 DIDLPWDKIRTVLESSLDASTASV--ALGRLQKGWELSK 211 ++ +PWD I +L+++ + A+V + RLQKGW L+K Sbjct: 174 ELTVPWDDIEALLKNNFENDQAAVRQVMERLQKGWSLAK 212 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.311 0.131 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,218,586 Number of Sequences: 60738 Number of extensions: 438942 Number of successful extensions: 1731 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1727 Number of HSP's gapped (non-prelim): 1 length of query: 211 length of database: 30,389,216 effective HSP length: 102 effective length of query: 109 effective length of database: 24,193,940 effective search space: 2637139460 effective search space used: 2637139460 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)