ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactI2036 suspect: LH J KOG0458 Translation, ribosomal structure and biogenesis Elongation factor 1 alpha

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactI2036 694308  694646 113  
         (113 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YKR084c [J] KOG0458 Elongation factor 1 alpha 84 2e-17 >YKR084c [J] KOG0458 Elongation factor 1 alpha Length = 611 Score = 84.3 bits (207), Expect = 2e-17 Identities = 35/57 (61%), Positives = 48/57 (83%) Query: 29 YLNDEEFELMNQLFPLAKEQLADYQGWDNLAVKVAIFDHNFELEPALVDLKRRFKKK 85 YLND+E++LMN++FP K QL DYQGWDNL++K+A+FD+NF+LE L +LK+ KKK Sbjct: 25 YLNDDEYDLMNEVFPTLKAQLQDYQGWDNLSLKLALFDNNFDLESTLAELKKTLKKK 81 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.330 0.144 0.497 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,273,697 Number of Sequences: 60738 Number of extensions: 186440 Number of successful extensions: 481 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 480 Number of HSP's gapped (non-prelim): 1 length of query: 113 length of database: 30,389,216 effective HSP length: 89 effective length of query: 24 effective length of database: 24,983,534 effective search space: 599604816 effective search space used: 599604816 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits)