ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactI2848.1    suspect: LH  T     KOG3577   Signal transduction mechanisms                                 Smoothened and related G-protein-coupled receptors

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactI2848.1 954770 954564 -69  
         (69 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

7304194_1 [T] KOG3577 Smoothened and related G-protein-coupled r...    29   1.0  

>7304194_1 [T] KOG3577 Smoothened and related G-protein-coupled receptors
          Length = 1077

 Score = 29.3 bits (64), Expect = 1.0
 Identities = 15/36 (41%), Positives = 20/36 (54%)

Query: 31  LASAENLSPMTKSVGKTILTLFFLAFSTNFGTNSAP 66
           LA+  N  P  K V KTI+    +  +T+FG N AP
Sbjct: 723 LAAYFNAYPTIKFVNKTIINTIHVEDTTSFGKNPAP 758


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.316    0.128    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,611,091
Number of Sequences: 60738
Number of extensions: 105563
Number of successful extensions: 256
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 255
Number of HSP's gapped (non-prelim): 1
length of query: 69
length of database: 30,389,216
effective HSP length: 45
effective length of query: 24
effective length of database: 27,656,006
effective search space: 663744144
effective search space used: 663744144
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)