ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactI3016 suspect: LH J KOG3301 Translation, ribosomal structure and biogenesis Ribosomal protein S4

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactI3016 1008568 1007123 -482 
         (482 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value AtCh025 [J] KOG3301 Ribosomal protein S4 52 2e-06 >AtCh025 [J] KOG3301 Ribosomal protein S4 Length = 201 Score = 52.0 bits (123), Expect = 2e-06 Identities = 37/118 (31%), Positives = 59/118 (49%), Gaps = 16/118 (13%) Query: 39 KTLYQQKWTSKQETRAYHGEHLTESRWQSVFEPQLNSVAQLDASLRGGDIEPTPILLQTY 98 K+ Y+ + KQ+ R ++G + E QL ++ +G + +LLQ Sbjct: 41 KSQYRIRLEEKQKLRFHYG----------LTEHQLLKYVRIAGKAKGSTGQ---VLLQ-- 85 Query: 99 AVLEKRLDFALFRAMFASSVRQARQFILHGNVHVNGVKITSPGYALKAGDVFNVRPEK 156 +LE RLD LFR A ++ QARQ + HG++ VNG + P Y K D+ V+ E+ Sbjct: 86 -LLEMRLDNILFRLGMALTIPQARQLVNHGHILVNGRIVDIPSYRCKPRDIITVKDEQ 142 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.318 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,220,044 Number of Sequences: 60738 Number of extensions: 1287454 Number of successful extensions: 3531 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3531 Number of HSP's gapped (non-prelim): 1 length of query: 482 length of database: 30,389,216 effective HSP length: 110 effective length of query: 372 effective length of database: 23,708,036 effective search space: 8819389392 effective search space used: 8819389392 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)