ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactI3137 suspect: LH R KOG3138 General function prediction only Predicted N-acetyltransferase

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactI3137 1052066  1052608 181  
         (181 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value At5g11340 [R] KOG3138 Predicted N-acetyltransferase 54 9e-08 >At5g11340 [R] KOG3138 Predicted N-acetyltransferase Length = 164 Score = 54.3 bits (129), Expect = 9e-08 Identities = 31/89 (34%), Positives = 50/89 (55%), Gaps = 1/89 (1%) Query: 91 QTEDMGTEYVELQRIYILQKYQGKGLGRVLMDKVHDIAQSYGKKKIWLGVWEHNQKAIDF 150 + ++ G V + + +L Y+G G+G L++ V D+ +I+L V +N+ AI F Sbjct: 67 EKKESGAMRVYIMTLGVLAPYRGIGIGSNLLNHVLDMCSKQNMCEIYLHVQTNNEDAIKF 126 Query: 151 YKKFGFEITGDHSFFVGDDEQRD-YIMEK 178 YKKFGFEIT + + E RD Y++ K Sbjct: 127 YKKFGFEITDTIQNYYINIEPRDCYVVSK 155 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.321 0.138 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,432,572 Number of Sequences: 60738 Number of extensions: 478179 Number of successful extensions: 1223 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1222 Number of HSP's gapped (non-prelim): 1 length of query: 181 length of database: 30,389,216 effective HSP length: 100 effective length of query: 81 effective length of database: 24,315,416 effective search space: 1969548696 effective search space used: 1969548696 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)