ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactII0211   suspect: LH   J     KOG3505  Translation, ribosomal structure and biogenesis                Mitochondrial/chloroplast ribosomal protein L33-like

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactII0211  67723  67935 71   
         (71 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YML009c [J] KOG3505 Mitochondrial/chloroplast ribosomal protein ...    84   3e-17

>YML009c [J] KOG3505 Mitochondrial/chloroplast ribosomal protein L33-like
          Length = 70

 Score = 84.3 bits (207), Expect = 3e-17
 Identities = 41/70 (58%), Positives = 50/70 (70%)

Query: 1  MAKAKTKTTVIKLISTAMTGVSRHVTINRAAPLVTQVRYDPVAKRHVLFXXXXXXXXXXX 60
          M K K+K +VIKL+STA +G SR+++I + APLVTQVRYDPV KRHVLF           
Sbjct: 1  MVKVKSKNSVIKLLSTAASGYSRYISIKKGAPLVTQVRYDPVVKRHVLFKEAKKRKVAER 60

Query: 61 XPLDFLRTAR 70
           PLDFLRTA+
Sbjct: 61 KPLDFLRTAK 70


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.326    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,400,701
Number of Sequences: 60738
Number of extensions: 49794
Number of successful extensions: 115
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 114
Number of HSP's gapped (non-prelim): 1
length of query: 71
length of database: 30,389,216
effective HSP length: 47
effective length of query: 24
effective length of database: 27,534,530
effective search space: 660828720
effective search space used: 660828720
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)