ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactII0405 suspect: LH R KOG4431 General function prediction only Uncharacterized protein, induced by hypoxia

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactII0405  135385 134912 -158 
         (158 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YML030w [R] KOG4431 Uncharacterized protein induced by hypoxia 181 3e-46 >YML030w [R] KOG4431 Uncharacterized protein induced by hypoxia Length = 159 Score = 181 bits (460), Expect = 3e-46 Identities = 91/158 (57%), Positives = 115/158 (72%) Query: 1 MSYLPSSFDSDADDLDEMPFLDKMIYHCKQQPLVPXXXXXXXXXXXXXXXNVKNGNKRKA 60 MS +PSSFD DLD+M F +++IYHCK+QPLVP NV+ GNK KA Sbjct: 1 MSRMPSSFDVTERDLDDMTFGERIIYHCKKQPLVPIGCLLTTGAVILAAQNVRLGNKWKA 60 Query: 61 QIWFRWRVALQGFTLIALVAGSYIYGTNKNERESHEEQLRKKAKMREQLWIQELERRDEE 120 Q +FRWRV LQ TL+ALVAGS+IYGT+ E ++ EEQL++KAKMRE+LWIQELERR+EE Sbjct: 61 QYYFRWRVGLQAATLVALVAGSFIYGTSGKELKAKEEQLKEKAKMREKLWIQELERREEE 120 Query: 121 TKLRRQKAELARQKAKEMEQETSKLQQELKDLEERLKK 158 T+ RR++AELAR K E E+E L++EL DLE +L K Sbjct: 121 TEARRKRAELARMKTLENEEEIKNLEKELSDLENKLGK 158 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.315 0.130 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,637,003 Number of Sequences: 60738 Number of extensions: 325376 Number of successful extensions: 7257 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7256 Number of HSP's gapped (non-prelim): 1 length of query: 158 length of database: 30,389,216 effective HSP length: 97 effective length of query: 61 effective length of database: 24,497,630 effective search space: 1494355430 effective search space used: 1494355430 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits)