ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactII0749.1   suspect: LH  P     KOG3927   Inorganic ion transport and metabolism                         Na+/K+ ATPase, beta subunit

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactII0749.1 265102 264875 -76  
         (76 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

7298197_2 [P] KOG3927 Na+/K+ ATPase beta subunit                       28   2.3  

>7298197_2 [P] KOG3927 Na+/K+ ATPase beta subunit
          Length = 302

 Score = 28.1 bits (61), Expect = 2.3
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 25 LFQISWFNF-GSNLTSSVPMCNLANFLISFTAFG 57
          +F ++WF+F   + +  VPM  +A   ISFT  G
Sbjct: 46 IFSMAWFDFIKDDASRKVPMIKMAQPFISFTPIG 79


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.328    0.139    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,674,702
Number of Sequences: 60738
Number of extensions: 108245
Number of successful extensions: 243
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 243
Number of HSP's gapped (non-prelim): 1
length of query: 76
length of database: 30,389,216
effective HSP length: 52
effective length of query: 24
effective length of database: 27,230,840
effective search space: 653540160
effective search space used: 653540160
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)