ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactII0842 suspect: LH C KOG4527 Energy production and conversion Cytochrome c oxidase, subunit VIIc/COX8

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactII0842  300590  300808 73   
         (73 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YLR395c [C] KOG4527 Cytochrome c oxidase subunit VIIc/COX8 83 6e-17 >YLR395c [C] KOG4527 Cytochrome c oxidase subunit VIIc/COX8 Length = 78 Score = 83.2 bits (204), Expect = 6e-17 Identities = 36/50 (72%), Positives = 41/50 (82%) Query: 24 HFKEGVYSNIPVKIHNRKIPYAFIHFGFFALGFAVPFISSYVQLKKFGAF 73 HFK+GVY NIP K+ RK PYA HFGFFA+GFAVPF++ YVQLKK GAF Sbjct: 29 HFKDGVYENIPFKVKGRKTPYALSHFGFFAIGFAVPFVACYVQLKKSGAF 78 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.332 0.142 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,832,547 Number of Sequences: 60738 Number of extensions: 127285 Number of successful extensions: 1078 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1077 Number of HSP's gapped (non-prelim): 1 length of query: 73 length of database: 30,389,216 effective HSP length: 49 effective length of query: 24 effective length of database: 27,413,054 effective search space: 657913296 effective search space used: 657913296 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits)