ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactII0951   suspect: LH   J     KOG0893  Translation, ribosomal structure and biogenesis                60S ribosomal protein L31

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactII0951  334206 333823 -128 
         (128 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Hs17453142 [J] KOG0893 60S ribosomal protein L31                       46   7e-06

>Hs17453142 [J] KOG0893 60S ribosomal protein L31
          Length = 346

 Score = 46.2 bits (108), Expect = 7e-06
 Identities = 23/65 (35%), Positives = 39/65 (59%)

Query: 12  DGQLDTLTLWQGDPWSTWFTDDENVVQSGDESVFQRILDVNQIETTFVSFSVDDGTNSTQ 71
           DG+ D L+L + +PW     +++NV +S  ++V   I ++N ++ + V  SVDD TNS+Q
Sbjct: 117 DGEADILSLGKRNPWFIALANNKNVEKSSGKAVAIGIFNINYVKRSRVLLSVDDHTNSSQ 176

Query: 72  VTTTG 76
               G
Sbjct: 177 ENDDG 181


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.313    0.129    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,670,435
Number of Sequences: 60738
Number of extensions: 281411
Number of successful extensions: 583
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 582
Number of HSP's gapped (non-prelim): 1
length of query: 128
length of database: 30,389,216
effective HSP length: 104
effective length of query: 24
effective length of database: 24,072,464
effective search space: 577739136
effective search space used: 577739136
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)