ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactII1094 suspect: LH S KOG2846 Function unknown Predicted membrane protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactII1094 387796 386966 -277 
         (277 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YHR192w [S] KOG2846 Predicted membrane protein 131 1e-30 >YHR192w [S] KOG2846 Predicted membrane protein Length = 278 Score = 131 bits (329), Expect = 1e-30 Identities = 82/280 (29%), Positives = 130/280 (46%), Gaps = 22/280 (7%) Query: 1 MLSAVRKIVSGDNDVKKLVQRYNKDLSSITNKIHDYETKLKGIEDRAKSLRATVTYYYLT 60 M SA+ K V G + K V +Y DLS IT++IH + LK + ++ +T+Y + Sbjct: 1 MFSALGKWVRGSRNDKDFVTKYTADLSQITSQIHQLDVALKKSQSILSQWQSNLTFYGIA 60 Query: 61 LLVCIIAYVYLKYSSSR------AILCSXXXXXXXXXXXXXXTRFYLMLNKKYESRLSAL 114 L V ++Y Y +Y R A+LC T+ Y N +L+ L Sbjct: 61 LTVLALSYTYWEYHGYRPYLVVTALLC----IGSLILFKWALTKLYAFYNNNRLRKLAKL 116 Query: 115 ISLHQEKMEELKQKTNFYHTNSLIQRYSSGESGSXXXXXXXXXEVKAKHXXXXXXXXXXX 174 ++HQ+K+E+LK++T++ T+S+IQR+SSGE + E+ AK+ Sbjct: 117 RAIHQKKLEKLKEETHYNATSSIIQRFSSGEDQNDDAMVLLDDELNAKYQELNNLKTELE 176 Query: 175 XXRTNEKQKTQDVEAREKWFDKALGILAGG---DDIKTLQPSISLIVCSQCKMSFGCYSV 231 + K E + WFDK + +LAGG D +L P I+C QC CY + Sbjct: 177 KFKKESHVKGLKKEDSDAWFDKIISVLAGGNELDSTSSLSP-FKKIICPQCHWKSNCYRL 235 Query: 232 AGVPFQYVCSNCGSKL--------ATKPSNTAAPASSKSE 263 A P ++C +C K+ A + A P+ S+ E Sbjct: 236 ASKPIIFICPHCNHKIDEVKEREDAIEAKQPAQPSQSEKE 275 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.314 0.129 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,582,237 Number of Sequences: 60738 Number of extensions: 470147 Number of successful extensions: 1802 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1798 Number of HSP's gapped (non-prelim): 1 length of query: 277 length of database: 30,389,216 effective HSP length: 105 effective length of query: 172 effective length of database: 24,011,726 effective search space: 4130016872 effective search space used: 4130016872 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)