ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactII1096 suspect: LH S KOG4487 Function unknown Uncharacterized conserved protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactII1096 388079  388477 133  
         (133 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YHR191c [S] KOG4487 Uncharacterized conserved protein 112 2e-25 >YHR191c [S] KOG4487 Uncharacterized conserved protein Length = 133 Score = 112 bits (279), Expect = 2e-25 Identities = 62/136 (45%), Positives = 86/136 (62%), Gaps = 6/136 (4%) Query: 1 MPSVDISVNQLIDIFAEDRDTPPTVSTSLGHVMIEIQGDLQHPQKSIDPAL---DVDSRF 57 MPSVDI +Q + + R+ TV T LG +M+EIQG+L+ P+ A + RF Sbjct: 1 MPSVDIDASQWQKL-TQSREKQTTVITPLGMMMLEIQGELELPKDFASLARRDSPNEGRF 59 Query: 58 IEHEGNGLVRFGILSYDLETKHVTLFIGNKQRLMGSIVKIEPPLGLLKFDKADGTVSLRD 117 E +G L+RFG L D E TLF+G KQRL+G + K++ P+G++ F+ D V L D Sbjct: 60 SEQDGETLIRFGSLQIDGE--RATLFVGKKQRLLGKVTKLDVPMGIMHFNSKDNKVELVD 117 Query: 118 VLKYKIIFKNRPLPIM 133 V+KYK+IFK+RPLPIM Sbjct: 118 VMKYKVIFKDRPLPIM 133 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.321 0.143 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,242,390 Number of Sequences: 60738 Number of extensions: 330706 Number of successful extensions: 617 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 614 Number of HSP's gapped (non-prelim): 1 length of query: 133 length of database: 30,389,216 effective HSP length: 94 effective length of query: 39 effective length of database: 24,679,844 effective search space: 962513916 effective search space used: 962513916 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)