ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactII1165 suspect: LH U KOG3368 Intracellular trafficking, secretion, and vesicular transport Transport protein particle (TRAPP) complex subunit

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactII1165 412826  413131 102  
         (102 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YML077w [U] KOG3368 Transport protein particle (TRAPP) complex s... 77 3e-15 >YML077w [U] KOG3368 Transport protein particle (TRAPP) complex subunit Length = 159 Score = 77.4 bits (189), Expect = 3e-15 Identities = 41/107 (38%), Positives = 66/107 (61%), Gaps = 7/107 (6%) Query: 1 MVHSLKAMSTKIAPG---NTLRTLTTGKYRIHALFTASNLWIVIFSDLTHHELHERLDKI 57 M+ SL++++ K++ G N +R+++TGKYR+H TAS LW V+ SD + L I Sbjct: 47 MIFSLRSITQKLSKGSVKNDIRSISTGKYRVHTYCTASGLWFVLLSDFKQQSYTQVLQYI 106 Query: 58 Y-ELYLKYVVHNMLKPIDLRESEN---AKESDKITSPSFIKAVDQVL 100 Y +Y+KYV +N+L P D E+EN + + KIT+ +FI ++ L Sbjct: 107 YSHIYVKYVSNNLLSPYDFAENENEMRGQGTRKITNRNFISVLESFL 153 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.321 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,931,489 Number of Sequences: 60738 Number of extensions: 224621 Number of successful extensions: 657 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 656 Number of HSP's gapped (non-prelim): 1 length of query: 102 length of database: 30,389,216 effective HSP length: 78 effective length of query: 24 effective length of database: 25,651,652 effective search space: 615639648 effective search space used: 615639648 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits)