ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactII1350 suspect: LH G KOG2504 Carbohydrate transport and metabolism Monocarboxylate transporter

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactII1350 480228 479995 -78  
         (78 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YKL221w [G] KOG2504 Monocarboxylate transporter 121 2e-28 >YKL221w [G] KOG2504 Monocarboxylate transporter Length = 473 Score = 121 bits (303), Expect = 2e-28 Identities = 55/78 (70%), Positives = 69/78 (87%) Query: 1 MWALCSWVSFTMLGYVILLYSLSAFTQSIGYNSKEGSYVSCMISVGSLIGRPLVGHIADR 60 +W L +VSF MLGYV+LLYSLS FT S+GY SK+GSYVSCM+SVGSL+GRP+VGHIAD+ Sbjct: 250 VWLLFGFVSFAMLGYVVLLYSLSDFTVSLGYTSKQGSYVSCMVSVGSLLGRPIVGHIADK 309 Query: 61 YGPITVGALVNLVVAILC 78 YG +TVG +++LV+AILC Sbjct: 310 YGSLTVGMILHLVMAILC 327 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.327 0.141 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,488,882 Number of Sequences: 60738 Number of extensions: 150737 Number of successful extensions: 565 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 564 Number of HSP's gapped (non-prelim): 1 length of query: 78 length of database: 30,389,216 effective HSP length: 54 effective length of query: 24 effective length of database: 27,109,364 effective search space: 650624736 effective search space used: 650624736 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits)