ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactII2370 suspect: LH WV KOG1216 Defense mechanisms von Willebrand factor and related coagulation proteins r_klactII2370 suspect: LH WV KOG1216 Extracellular structures von Willebrand factor and related coagulation proteins

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactII2370 829446 826870 -859 
         (859 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value Hs4505285 [WV] KOG1216 von Willebrand factor and related coagula... 54 8e-07 >Hs4505285 [WV] KOG1216 von Willebrand factor and related coagulation proteins Length = 5179 Score = 54.3 bits (129), Expect = 8e-07 Identities = 61/267 (22%), Positives = 82/267 (29%), Gaps = 27/267 (10%) Query: 505 PLPSRNVRPPTSVDHTKPNTVTPAAATGTSAEVGDDQVRPNESITGVYHESTVSFPPPPK 564 PLP+ PP S T P T TP+ T T P+ T +T + PPP Sbjct: 1448 PLPTTTPSPPISTTTTPPPTTTPSPPTTT----------PSPPTTTPSPPTTTTTTPPPT 1497 Query: 565 PTHNGLPMSPPVSHARPTVSHKXXXXXXXXXXXXXXXXXIQTHQRITSTERAPIGRPKEE 624 T + PM+ P++ T + T T+T PI P Sbjct: 1498 TTPSP-PMTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTT---PITPPTST 1553 Query: 625 VHQAAVLGAYNYNVDVGFAPPPKPPRSMVTSPANDPQTSLSSRRPSQEYGGVAKASSRTL 684 P PP + T P + ++ PS T Sbjct: 1554 TTLPPT------------TTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTT 1601 Query: 685 PPPPGQQNGSLPQHTXXXXXXXXXXXXXXXMRMLPLADLPPPPQRTDSHTTTSEQPAVPS 744 P PP + P T LP P PP T + + P+ P+ Sbjct: 1602 PSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPT 1661 Query: 745 RTFDPPPRYSTNETIPPTYNIDEDIQT 771 T P P +T T PPT I T Sbjct: 1662 TT-TPSPPITTTTTPPPTTTPSSPITT 1687 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.307 0.126 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,043,699 Number of Sequences: 60738 Number of extensions: 1633603 Number of successful extensions: 7894 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7801 Number of HSP's gapped (non-prelim): 19 length of query: 859 length of database: 30,389,216 effective HSP length: 115 effective length of query: 744 effective length of database: 23,404,346 effective search space: 17412833424 effective search space used: 17412833424 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits)