ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactII2848 suspect: LH J KOG1749 Translation, ribosomal structure and biogenesis 40S ribosomal protein S23

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactII2848 983313 982978 -112 
         (112 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YPR132w [J] KOG1749 40S ribosomal protein S23 49 9e-07 YGR118w [J] KOG1749 40S ribosomal protein S23 49 9e-07 >YPR132w [J] KOG1749 40S ribosomal protein S23 Length = 145 Score = 49.3 bits (116), Expect = 9e-07 Identities = 33/71 (46%), Positives = 42/71 (58%), Gaps = 16/71 (22%) Query: 1 MGKGKPRGLNSARKLRVHRRN--------KYVIIDTRLK-------SFEKVITECERVGL 45 MGKGKPRGLNSARKLRVHRRN K ++ T K S K I E++G+ Sbjct: 1 MGKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKGIV-LEKLGI 59 Query: 46 KSEEDNNKDRK 56 +S++ N+ RK Sbjct: 60 ESKQPNSAIRK 70 >YGR118w [J] KOG1749 40S ribosomal protein S23 Length = 145 Score = 49.3 bits (116), Expect = 9e-07 Identities = 33/71 (46%), Positives = 42/71 (58%), Gaps = 16/71 (22%) Query: 1 MGKGKPRGLNSARKLRVHRRN--------KYVIIDTRLK-------SFEKVITECERVGL 45 MGKGKPRGLNSARKLRVHRRN K ++ T K S K I E++G+ Sbjct: 1 MGKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKGIV-LEKLGI 59 Query: 46 KSEEDNNKDRK 56 +S++ N+ RK Sbjct: 60 ESKQPNSAIRK 70 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.318 0.135 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,814,709 Number of Sequences: 60738 Number of extensions: 264099 Number of successful extensions: 888 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 886 Number of HSP's gapped (non-prelim): 2 length of query: 112 length of database: 30,389,216 effective HSP length: 88 effective length of query: 24 effective length of database: 25,044,272 effective search space: 601062528 effective search space used: 601062528 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)