ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactII3403 suspect: LH J KOG4708 Translation, ribosomal structure and biogenesis Mitochondrial ribosomal protein MRP17

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactII3403 1171833  1172219 129  
         (129 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YKL003c [J] KOG4708 Mitochondrial ribosomal protein MRP17 161 2e-40 SPAC343.08c [J] KOG4708 Mitochondrial ribosomal protein MRP17 58 3e-09 >YKL003c [J] KOG4708 Mitochondrial ribosomal protein MRP17 Length = 131 Score = 161 bits (408), Expect = 2e-40 Identities = 82/121 (67%), Positives = 99/121 (81%) Query: 1 MLYELVSIVRVSNPLAANAEAKELATTIGKLIIQNRGVVRKIVPMGNKLLPKIIKKDQEQ 60 MLYEL+ +VR++N A EAKEL++TIGKLIIQNRGVVR IVPMG + LPKI+KKDQE+ Sbjct: 1 MLYELIGLVRITNSNAPKLEAKELSSTIGKLIIQNRGVVRDIVPMGIRYLPKIMKKDQEK 60 Query: 61 HFQGYHFLMLFDSSAPVQSEILRTLKKDPRVIRSNIIKLSTHKKLDIPTSFERATGNLTS 120 HF+ YHFLMLFDSSA VQSEILRTLKKDPRVIRS+I+K+ K+LD +S R+ G + Sbjct: 61 HFRAYHFLMLFDSSAAVQSEILRTLKKDPRVIRSSIVKVDLDKQLDRASSLHRSLGKKSI 120 Query: 121 L 121 L Sbjct: 121 L 121 >SPAC343.08c [J] KOG4708 Mitochondrial ribosomal protein MRP17 Length = 109 Score = 58.2 bits (139), Expect = 3e-09 Identities = 41/104 (39%), Positives = 56/104 (53%), Gaps = 11/104 (10%) Query: 2 LYELVSIVRVSNPLAANAE-------AKELATTIGKLIIQNRGVVRKIVPMGNKLLPKII 54 +YEL I R AANA A +A G+ I+ N+GVV + MG K L K I Sbjct: 1 MYELFCITRP----AANATRTSSPTLAMNIAKNCGRAILDNKGVVVDVESMGLKELAKPI 56 Query: 55 KKDQEQHFQGYHFLMLFDSSAPVQSEILRTLKKDPRVIRSNIIK 98 KK + + G+ + M F S+ VQSEI R L+ +P V+R I+K Sbjct: 57 KKLNQSYSFGHWWSMTFYSNPTVQSEIQRILRLEPSVLRYMIVK 100 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.318 0.134 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,995,214 Number of Sequences: 60738 Number of extensions: 256616 Number of successful extensions: 643 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 641 Number of HSP's gapped (non-prelim): 2 length of query: 129 length of database: 30,389,216 effective HSP length: 94 effective length of query: 35 effective length of database: 24,679,844 effective search space: 863794540 effective search space used: 863794540 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)