ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactII3414 suspect: LH J KOG3421 Translation, ribosomal structure and biogenesis 60S ribosomal protein L14

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactII3414 1175681 1175490 -64  
         (64 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YKL006w [J] KOG3421 60S ribosomal protein L14 80 5e-16 YHL001w [J] KOG3421 60S ribosomal protein L14 80 5e-16 >YKL006w [J] KOG3421 60S ribosomal protein L14 Length = 138 Score = 80.1 bits (196), Expect = 5e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Query: 1 MSTDSVVKASNWRLVEVGRVVLVKQGQSAGKLATIVEIIDQKRV 44 MSTDS+VKASNWRLVEVGRVVL+K+GQSAGKLA IVEIIDQK+V Sbjct: 1 MSTDSIVKASNWRLVEVGRVVLIKKGQSAGKLAAIVEIIDQKKV 44 >YHL001w [J] KOG3421 60S ribosomal protein L14 Length = 138 Score = 80.1 bits (196), Expect = 5e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Query: 1 MSTDSVVKASNWRLVEVGRVVLVKQGQSAGKLATIVEIIDQKRV 44 MSTDS+VKASNWRLVEVGRVVL+K+GQSAGKLA IVEIIDQK+V Sbjct: 1 MSTDSIVKASNWRLVEVGRVVLIKKGQSAGKLAAIVEIIDQKKV 44 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.319 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,457,529 Number of Sequences: 60738 Number of extensions: 96550 Number of successful extensions: 194 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 192 Number of HSP's gapped (non-prelim): 2 length of query: 64 length of database: 30,389,216 effective HSP length: 40 effective length of query: 24 effective length of database: 27,959,696 effective search space: 671032704 effective search space used: 671032704 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)