ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactII3580 suspect: LH S KOG4774 Function unknown Uncharacterized conserved protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactII3580 1230185 1229760 -142 
         (142 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YJR067c [S] KOG4774 Uncharacterized conserved protein 102 1e-22 SPAC2C4.12c_2 [S] KOG4774 Uncharacterized conserved protein 53 1e-07 >YJR067c [S] KOG4774 Uncharacterized conserved protein Length = 141 Score = 102 bits (255), Expect = 1e-22 Identities = 59/133 (44%), Positives = 80/133 (59%), Gaps = 3/133 (2%) Query: 9 ENIWGSDNEASTGPQESLEVKKLQQIHSKRGYLDGISSAKEENLQAGFDDTFPLGAKYGF 68 +++W SD++ T + S ++ KL++ HSKRGYLDGI S+KEE LQ GF+D FP GAK G Sbjct: 6 DDVWASDSDVET--ERSPDLVKLRENHSKRGYLDGIVSSKEEKLQEGFNDGFPTGAKLGK 63 Query: 69 QIGEIVGKLRLFTTLYGNADPQVAADLKQAQDELRINRVLSARHFDEELQPLDSLKVLLS 128 Q+G I+G L T +G+ D ++ AQ ELRIN+VLS FD L L++ Sbjct: 64 QVGIIMGILLGLRTRFGDEDEDLSKAYIDAQKELRINKVLSKSIFDPNFD-LQEKHPLIT 122 Query: 129 KWQARVLDYEGKY 141 KW Y KY Sbjct: 123 KWTDIANTYCEKY 135 >SPAC2C4.12c_2 [S] KOG4774 Uncharacterized conserved protein Length = 136 Score = 53.1 bits (126), Expect = 1e-07 Identities = 33/95 (34%), Positives = 53/95 (55%), Gaps = 5/95 (5%) Query: 27 EVKKLQQIHSKRGYLDGISSAKEENLQAGFDDTFPLGAKYGFQIGEIVGKLRLFTTLYGN 86 E++ L++ HS GY +GI K + Q+GFDD F G++ GFQ+G+ +G L+ LY Sbjct: 39 ELELLEEKHSNFGYSEGIIKGKMQVAQSGFDDGFKHGSRLGFQMGKTIGTLK--AKLYIF 96 Query: 87 ADPQVAADLKQAQDELRIN---RVLSARHFDEELQ 118 + + LKQ D L+ + + A H +E L+ Sbjct: 97 EENEQMEILKQELDRLQESAEFHIFVANHKEEILK 131 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.313 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,431,129 Number of Sequences: 60738 Number of extensions: 321210 Number of successful extensions: 656 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 654 Number of HSP's gapped (non-prelim): 2 length of query: 142 length of database: 30,389,216 effective HSP length: 96 effective length of query: 46 effective length of database: 24,558,368 effective search space: 1129684928 effective search space used: 1129684928 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)