ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII0203 suspect: LH Z KOG0516 Cytoskeleton Dystonin, GAS (Growth-arrest-specific protein), and related proteins

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII0203  66498 65446 -351 
         (351 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value Hs21553341 [Z] KOG0516 Dystonin GAS (Growth-arrest-specific prot... 50 4e-06 >Hs21553341 [Z] KOG0516 Dystonin GAS (Growth-arrest-specific protein) and related proteins Length = 6885 Score = 50.4 bits (119), Expect = 4e-06 Identities = 59/298 (19%), Positives = 119/298 (39%), Gaps = 41/298 (13%) Query: 8 YYSEVEKFEYQVTHVTEQILQEQDRLRGSTLHEYNQTILQLVSDYEMFNSNGQCDPSEIN 67 ++S++ + + +V + EQ E+ ++ Y+ + +C S++N Sbjct: 3730 WHSKLNELDSEVQDIVEQ--------DPGQAQEWMDNLMIPFQQYQQVSQRAECRTSQLN 3781 Query: 68 LPLEKLESWTNSLKQIHLELESIDNFLRYAIPSD-----------QTILNLSKFNESKYE 116 K+E +++ LK +E+ + L A P+D T+ + +E K+ Sbjct: 3782 KATVKMEEYSDLLKSTEAWIENTSHLL--ANPADYDSLRTLSHHASTVQMALEDSEQKHN 3839 Query: 117 TLQAEVSELRDINVVQLQKEIESLQQQITTKSDENLLISEKIKESCLEASQDIDQCWKLL 176 L + +L D++++ E + L Q I S++ + +KI ES + + D + Sbjct: 3840 LLHSIFMDLEDLSII---FETDELTQSIQELSNQVTALQQKIMESLPQIQRMADDVVAIE 3896 Query: 177 EQLEAYENANPSTEVITTTDPAFSTYNQWKWNQLAESELKHINQQLITLRATKEKLDKVF 236 ++++ E + I + F + E LKH L +R K+ + ++ Sbjct: 3897 SEVKSMEKRVSKIKTILLSKEIF--------DFSPEEHLKHGEVILENIRPMKKTIAEIV 3948 Query: 237 SKRSELETSPKSIETFTSYQLLSQLWRSKFIRQLLPDIANLEVYPQSGKLKFEVGIMQ 294 S + EL ++ +Q + QLL DI LE Q +V I Q Sbjct: 3949 SYQVELRLPQTGMKPLPVFQRTN---------QLLQDIKLLENVTQEQNELLKVVIKQ 3997 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.313 0.130 0.355 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,604,684 Number of Sequences: 60738 Number of extensions: 794105 Number of successful extensions: 2909 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2906 Number of HSP's gapped (non-prelim): 4 length of query: 351 length of database: 30,389,216 effective HSP length: 107 effective length of query: 244 effective length of database: 23,890,250 effective search space: 5829221000 effective search space used: 5829221000 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)