ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII0215 suspect: LH R KOG1773 General function prediction only Stress responsive protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII0215  69352 69128 -75  
         (75 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YDR525w-a [R] KOG1773 Stress responsive protein 84 5e-17 >YDR525w-a [R] KOG1773 Stress responsive protein Length = 79 Score = 83.6 bits (205), Expect = 5e-17 Identities = 42/79 (53%), Positives = 49/79 (61%), Gaps = 4/79 (5%) Query: 1 MHARDWFLVFIAIFLPPVAVWIKRGFFTKDXXXXXXXXXXXXXXXXIHALWVISKHPYES 60 MHARDWFLVFIAIF+PP+AVW+KRGFFTKD IHAL+VIS HPYE Sbjct: 1 MHARDWFLVFIAIFIPPLAVWLKRGFFTKDLLINFLLFLLGFFPGLIHALYVISCHPYEE 60 Query: 61 E----GDVLSRGQGYGSMS 75 + S YGS++ Sbjct: 61 NEARYSHLSSSDDNYGSLA 79 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.328 0.143 0.489 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,959,174 Number of Sequences: 60738 Number of extensions: 83716 Number of successful extensions: 144 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 142 Number of HSP's gapped (non-prelim): 1 length of query: 75 length of database: 30,389,216 effective HSP length: 51 effective length of query: 24 effective length of database: 27,291,578 effective search space: 654997872 effective search space used: 654997872 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits)