ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII0312 suspect: LH U KOG1087 Intracellular trafficking, secretion, and vesicular transport Cytosolic sorting protein GGA2/TOM1

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII0312  103218  104222 335  
         (335 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value SPBC31F10.07 [U] KOG1087 Cytosolic sorting protein GGA2/TOM1 97 3e-20 >SPBC31F10.07 [U] KOG1087 Cytosolic sorting protein GGA2/TOM1 Length = 304 Score = 97.1 bits (240), Expect = 3e-20 Identities = 92/341 (26%), Positives = 160/341 (45%), Gaps = 44/341 (12%) Query: 1 MGFFTDH-PYTSVTESINKAVISENATLEVELGNILQLIRTGD-TDTNQVEAARAIRKRL 58 MG F++ P T+VT I++ ++ T + +L I+QL + T T EA+R +RK+L Sbjct: 1 MGIFSETVPITAVTTYIDR--LTSRDTDDEDLSGIVQLSEAVNLTVTGPREASRTLRKKL 58 Query: 59 KHGDLYQQSRALDLLNLFVSQL-IHLPLFYSDFRLINVLLDMSSNSGKYPKQISRKCTCY 117 K+ ++Q RAL +L + H +SD +L + +L ++NS +Y K + ++ Sbjct: 59 KYSTPHEQVRALVILQALIENAGSHFLQNFSDEKLEDRMLQCATNS-EYSKPVRKRAIHM 117 Query: 118 LIGWYQYLASHQEVEGFEMLFTVCEKAYKNKKRHTKVMNKSYQKKKKALPQFLSDTADRR 177 + W+ + V G E + ++ + LPQ S + Sbjct: 118 IKLWHN---DYSNVRGMESMSSLVSR----------------------LPQRQSSASHSE 152 Query: 178 AVTADERYGIPRIDLEKEAPKIKLLISDSLETAVSLSNALLAI-PAHSKSTDSELCTAKF 236 P I+L+K P ++ LI+ S A +LSN+L+ I P ++ + Sbjct: 153 Q---------PTINLKKVGPILERLIASSSMAATNLSNSLVRINPNTENPAKNKQIMVYY 203 Query: 237 VQARALRRKVLRYLQLITGGELLGALLHANEELVNALMAF-DQLAEEGDMASLNERDSDE 295 V + R +LRY+Q I L LL AN+E+V A+ AF ++ +E D +S + S Sbjct: 204 VDCKRAHRSLLRYIQAIQDEMWLANLLKANDEIVTAIDAFKEKCSENSDYSSDSGSYSSS 263 Query: 296 DDQ--EDNEAYISDEASIPSYTSRGGAAQPNDPFSDNNKIK 334 + +D +YIS +S S R N+PF D+N+++ Sbjct: 264 YSRHLDDRASYISRSSSGGSNAQRSEDLDVNNPFGDHNRLE 304 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.316 0.132 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,108,542 Number of Sequences: 60738 Number of extensions: 793714 Number of successful extensions: 4596 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4594 Number of HSP's gapped (non-prelim): 2 length of query: 335 length of database: 30,389,216 effective HSP length: 107 effective length of query: 228 effective length of database: 23,890,250 effective search space: 5446977000 effective search space used: 5446977000 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)