ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII0454 suspect: LH J KOG3475 Translation, ribosomal structure and biogenesis 60S ribosomal protein L37

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII0454  149571  149705 45   
         (45 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YDR500c [J] KOG3475 60S ribosomal protein L37 58 2e-09 YLR185w [J] KOG3475 60S ribosomal protein L37 52 2e-07 >YDR500c [J] KOG3475 60S ribosomal protein L37 Length = 88 Score = 58.2 bits (139), Expect = 2e-09 Identities = 27/44 (61%), Positives = 28/44 (63%) Query: 2 RSHNWXXXXXXXXXXXXXXMRYLKHVSRRFKNGFQSGEAKAQSA 45 RSHNW MRYLKHVSRRFKNGFQ+G AKA SA Sbjct: 45 RSHNWAAKAKRRHTTGTGRMRYLKHVSRRFKNGFQTGSAKATSA 88 >YLR185w [J] KOG3475 60S ribosomal protein L37 Length = 88 Score = 51.6 bits (122), Expect = 2e-07 Identities = 24/44 (54%), Positives = 26/44 (58%) Query: 2 RSHNWXXXXXXXXXXXXXXMRYLKHVSRRFKNGFQSGEAKAQSA 45 RS+NW MRYLKHVSRRFKNGFQ+G A SA Sbjct: 45 RSYNWGAKAKRRHTTGTGRMRYLKHVSRRFKNGFQTGSASKASA 88 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.321 0.126 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,683,598 Number of Sequences: 60738 Number of extensions: 23753 Number of successful extensions: 54 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 52 Number of HSP's gapped (non-prelim): 2 length of query: 45 length of database: 30,389,216 effective HSP length: 21 effective length of query: 24 effective length of database: 29,113,718 effective search space: 698729232 effective search space used: 698729232 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits)