ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII0708 suspect: LH R KOG2950 General function prediction only Uncharacterized protein involved in protein-protein interaction, contains polyproline-binding GYF domain

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII0708  237655  238629 325  
         (325 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YHR156c [R] KOG2950 Uncharacterized protein involved in protein-... 129 6e-30 >YHR156c [R] KOG2950 Uncharacterized protein involved in protein-protein interaction contains polyproline-binding GYF domain Length = 340 Score = 129 bits (324), Expect = 6e-30 Identities = 71/226 (31%), Positives = 123/226 (54%), Gaps = 10/226 (4%) Query: 104 VQIEAFNMEEELKNGTVDKVGN--ATGKTINDDFENEDQWIQDFSSKESIKRAREAHENS 161 V IE FN+++E+K+G DK GN T +D ++ ++W+ D + E + R + E S Sbjct: 121 VNIEPFNIDDEIKHGVFDKDGNYIKTENATENDQQDNEEWMNDVINTEEVNRLEK--EQS 178 Query: 162 QTLQRKKRARMLYRLEEVLEQLYYF-VPRGKTIQEALILLQQLRKSLPKEHKERTKYIAN 220 Q + Y + E L L +F V +T+ E+L L +LRK + + KY+ + Sbjct: 179 VKTQNSRH----YMVHEALNLLKFFLVDENETVLESLGRLNKLRKIAISKKNKSLKYVIH 234 Query: 221 AIQIILTLVNVLEQKGIDNPMQLQKEGIRELYDEENLMGST-IDDVESKNWVFKWFADFE 279 I+++ L+N+LE+KG + + +++ +EE S+ I + ++K W FKW + Sbjct: 235 GIELLSDLINILEKKGFSEVYEYNRLKVQDAIEEEIFDDSSRIVNHKTKLWGFKWLNKLD 294 Query: 280 TAHESFSNYEMQTWKEKYFNSSVVVKRKCDTDETDHWYHVDCIYFM 325 H ++NYEM W++ YF +SV+VK + D ++W HV C+ FM Sbjct: 295 EYHGLYTNYEMSYWQKSYFKNSVIVKFHSEPDRDENWIHVSCLSFM 340 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.314 0.131 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,283,673 Number of Sequences: 60738 Number of extensions: 673772 Number of successful extensions: 1927 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1924 Number of HSP's gapped (non-prelim): 1 length of query: 325 length of database: 30,389,216 effective HSP length: 107 effective length of query: 218 effective length of database: 23,890,250 effective search space: 5208074500 effective search space used: 5208074500 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)