ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII0815 suspect: LH S KOG3869 Function unknown Uncharacterized conserved protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII0815  275942 275325 -206 
         (206 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YNL245c [S] KOG3869 Uncharacterized conserved protein 85 6e-17 >YNL245c [S] KOG3869 Uncharacterized conserved protein Length = 179 Score = 85.1 bits (209), Expect = 6e-17 Identities = 58/156 (37%), Positives = 74/156 (47%), Gaps = 15/156 (9%) Query: 3 DLNLLKSWNPKLVKNRKKVWEAQQQLVXXXXXXXXXXXXXXXXXXLDRY---SSLIRDED 59 DLNLLKSWNPKL+KNRKKVWE +Q L+ L+ SS + E Sbjct: 5 DLNLLKSWNPKLMKNRKKVWETEQDLITEQQKLNTRLKEIEKERELNELLNESSKDKPET 64 Query: 60 QKN--VKRKTGLEWMYDNTSTALTENVDYLLGKKEITDTLLDLSGXXXXXXXXXXXXXTI 117 KN +K+GLEWMY + + E DYLLGKK++ ++L+ Sbjct: 65 LKNDLALKKSGLEWMYQDAKLS-DEKEDYLLGKKKLDSSILNQPATPPVRAATTISA--- 120 Query: 118 RKHYQGIEDVICSKTNHKNVDLSSDDPMAKFKAAKQ 153 G I S+ K L DDPM+KFK KQ Sbjct: 121 ----SGAATSISSQ--KKKSKLLKDDPMSKFKVTKQ 150 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.312 0.129 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,371,812 Number of Sequences: 60738 Number of extensions: 290614 Number of successful extensions: 561 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 557 Number of HSP's gapped (non-prelim): 1 length of query: 206 length of database: 30,389,216 effective HSP length: 101 effective length of query: 105 effective length of database: 24,254,678 effective search space: 2546741190 effective search space used: 2546741190 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)