ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII0855.1  suspect: LH  U     KOG0058   Intracellular trafficking, secretion, and vesicular transport  Peptide exporter, ABC superfamily

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII0855.1 294667 294548 -40  
         (40 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC9B6.09c [U] KOG0058 Peptide exporter ABC superfamily               28   3.2  

>SPBC9B6.09c [U] KOG0058 Peptide exporter ABC superfamily
          Length = 726

 Score = 27.7 bits (60), Expect = 3.2
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 4   IAVGAFSYHSYEKKVQRPEGHTLNELLKKKWDRMSN 39
           IA+GAF Y  Y +K+ R     L +L +   ++++N
Sbjct: 315 IALGAFFYGEYVRKLSRTTQDALGDLTRVSEEKLAN 350


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.317    0.130    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,389,978
Number of Sequences: 60738
Number of extensions: 51011
Number of successful extensions: 118
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 117
Number of HSP's gapped (non-prelim): 1
length of query: 40
length of database: 30,389,216
effective HSP length: 16
effective length of query: 24
effective length of database: 29,417,408
effective search space: 706017792
effective search space used: 706017792
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)