ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII1754 suspect: LH A KOG0106 RNA processing and modification Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily)

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII1754 624694  625584 297  
         (297 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value At3g61860 [A] KOG0106 Alternative splicing factor SRp55/B52/SRp7... 52 1e-06 >At3g61860 [A] KOG0106 Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) Length = 271 Score = 51.6 bits (122), Expect = 1e-06 Identities = 33/91 (36%), Positives = 47/91 (51%), Gaps = 8/91 (8%) Query: 7 VHVSGFPAGTRANELAPQFENVGRLVRIDIPPLGRFKSIPYAFVEYESSHDAENAIRSCD 66 V V F TR ++L F+ GR+ R+D+ YAFV +E DAE+AIR D Sbjct: 4 VFVGNFEYETRQSDLERLFDKYGRVDRVDMKS-------GYAFVYFEDERDAEDAIRKLD 56 Query: 67 GTPFEMNKSFSLRVQFARSKPRRDFGDSRDP 97 PF K L V++A+ + R GD++ P Sbjct: 57 NFPFGYEKR-RLSVEWAKGERGRPRGDAKAP 86 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.311 0.132 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,344,254 Number of Sequences: 60738 Number of extensions: 580117 Number of successful extensions: 1694 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1693 Number of HSP's gapped (non-prelim): 1 length of query: 297 length of database: 30,389,216 effective HSP length: 106 effective length of query: 191 effective length of database: 23,950,988 effective search space: 4574638708 effective search space used: 4574638708 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)