ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII2117 suspect: LH S KOG4034 Function unknown Uncharacterized conserved protein NOF (Neighbor of FAU)

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII2117 751571  752101 177  
         (177 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YCR071c [S] KOG4034 Uncharacterized conserved protein NOF (Neigh... 139 2e-33 >YCR071c [S] KOG4034 Uncharacterized conserved protein NOF (Neighbor of FAU) Length = 146 Score = 139 bits (351), Expect = 2e-33 Identities = 67/104 (64%), Positives = 83/104 (79%), Gaps = 1/104 (0%) Query: 75 VFPKLEDVSPEEVVGAAPFGKKTYFIQRSINGNLPVYTDYKNS-NKIVTEIRKIQGDPVQ 133 +FPKLEDV E++G FGKKTY+++RS GNLPVY+ YKN NKI+TEIRKI+GD +Q Sbjct: 43 IFPKLEDVKMHELIGNNNFGKKTYYVERSRTGNLPVYSAYKNGGNKIITEIRKIEGDVIQ 102 Query: 134 LRNDLQERLPFIPKKYWKVILQSNKIIIEGDATKHVKRALATTF 177 LRNDLQE+LPFIPKK W V++QS KIII+G+A + VKR L F Sbjct: 103 LRNDLQEQLPFIPKKSWSVVMQSKKIIIKGNAVEAVKRVLTKKF 146 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.317 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,101,526 Number of Sequences: 60738 Number of extensions: 353613 Number of successful extensions: 975 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 973 Number of HSP's gapped (non-prelim): 1 length of query: 177 length of database: 30,389,216 effective HSP length: 99 effective length of query: 78 effective length of database: 24,376,154 effective search space: 1901340012 effective search space used: 1901340012 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)