ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII2336 good O KOG3470 Posttranslational modification, protein turnover, chaperones Beta-tubulin folding cofactor A

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII2336 824297 823983 -105 
         (105 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YOR265w [O] KOG3470 Beta-tubulin folding cofactor A 135 9e-33 Hs4759212 [O] KOG3470 Beta-tubulin folding cofactor A 60 7e-10 At2g30410 [O] KOG3470 Beta-tubulin folding cofactor A 53 6e-08 7302085 [O] KOG3470 Beta-tubulin folding cofactor A 52 2e-07 >YOR265w [O] KOG3470 Beta-tubulin folding cofactor A Length = 106 Score = 135 bits (340), Expect = 9e-33 Identities = 63/103 (61%), Positives = 86/103 (83%) Query: 1 MAPTQLEIKERALKRLCKEEHFYQEELEQQKLHVKKLQSDPSVDPYDLKKQVEVQQDTER 60 MAPTQL+IK +ALKRL KEE +YQ+EL+ Q+ HV KL+ D SVDPYDLKKQ EV DT+R Sbjct: 1 MAPTQLDIKVKALKRLTKEEGYYQQELKDQEAHVAKLKEDKSVDPYDLKKQEEVLDDTKR 60 Query: 61 LLPELYKKIKQFRDDLDKYLSSYEGTEDLESAKAALETADELL 103 LLP LY+KI++F++DL+++L +Y+GTED+ A++A+ +A ELL Sbjct: 61 LLPTLYEKIREFKEDLEQFLKTYQGTEDVSDARSAITSAQELL 103 >Hs4759212 [O] KOG3470 Beta-tubulin folding cofactor A Length = 108 Score = 59.7 bits (143), Expect = 7e-10 Identities = 29/98 (29%), Positives = 60/98 (60%), Gaps = 1/98 (1%) Query: 5 QLEIKERALKRLCKEEHFYQEELEQQKLHVKKLQSDPSVDPYDLKKQVEVQQDTERLLPE 64 Q++IK +KRL KE+ Y++E +QQ+ ++K++++ + YD+KKQ E+ Q++ ++P+ Sbjct: 8 QIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDG-ENYDIKKQAEILQESRMMIPD 66 Query: 65 LYKKIKQFRDDLDKYLSSYEGTEDLESAKAALETADEL 102 ++++ DL + L + + E+ E K A D + Sbjct: 67 CQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSV 104 >At2g30410 [O] KOG3470 Beta-tubulin folding cofactor A Length = 101 Score = 53.1 bits (126), Expect = 6e-08 Identities = 26/78 (33%), Positives = 46/78 (58%), Gaps = 1/78 (1%) Query: 6 LEIKERALKRLCKEEHFYQEELEQQKLHVKKLQSDPSVDPYDLKKQVEVQQDTERLLPEL 65 L+IK KR+ KE H Y++E+E++ ++ D DPYDLK+Q V ++ ++P+ Sbjct: 7 LKIKTSTCKRIVKELHSYEKEVEREAAKTADMK-DKGADPYDLKQQENVLGESRMMIPDC 65 Query: 66 YKKIKQFRDDLDKYLSSY 83 +K+++ DL L +Y Sbjct: 66 HKRLESALADLKSTLVNY 83 >7302085 [O] KOG3470 Beta-tubulin folding cofactor A Length = 110 Score = 51.6 bits (122), Expect = 2e-07 Identities = 34/104 (32%), Positives = 62/104 (58%), Gaps = 11/104 (10%) Query: 5 QLEIKERALKRLCKEEHFYQEELEQQKLHVKKLQSDPSVDPYDLKKQVEVQQDTERLLPE 64 QL IK ++RL +E++ Y +E+ ++ ++KL+ D D + L+KQ EV Q+ ++P+ Sbjct: 8 QLVIKSGVVRRLTREKYCYAKEVLTEQARLEKLRGD-GADDHVLRKQEEVIQECIMMVPD 66 Query: 65 LYKKIKQFRDDLDKYLS---------SY-EGTEDLESAKAALET 98 +++++ + L+KYL+ SY + E L+ AKA LET Sbjct: 67 SKRRLQKEYEVLEKYLADEQDLIETDSYKKAAEILKDAKAELET 110 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.309 0.130 0.343 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,455,891 Number of Sequences: 60738 Number of extensions: 270112 Number of successful extensions: 1504 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 1501 Number of HSP's gapped (non-prelim): 4 length of query: 105 length of database: 30,389,216 effective HSP length: 81 effective length of query: 24 effective length of database: 25,469,438 effective search space: 611266512 effective search space used: 611266512 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)