ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII2753 suspect: LH J KOG3311 Translation, ribosomal structure and biogenesis Ribosomal protein S18

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII2753 971068  971478 137  
         (137 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YNL081c [J] KOG3311 Ribosomal protein S18 185 1e-47 SPCC1795.07 [J] KOG3311 Ribosomal protein S18 102 2e-22 >YNL081c [J] KOG3311 Ribosomal protein S18 Length = 143 Score = 185 bits (470), Expect = 1e-47 Identities = 91/130 (70%), Positives = 102/130 (78%) Query: 1 MVVHXXXXXXXXXXXXXXXLASKFYGIGLKTAEKICSKLGFYPWMRMHQLTEPQVMAITS 60 MVVH LASKFYGIG TAEKICSKLGFYPWMRMHQL+EPQ+M+I S Sbjct: 1 MVVHILGKGFKGKEVIKIALASKFYGIGKTTAEKICSKLGFYPWMRMHQLSEPQIMSIAS 60 Query: 61 ELANMTIEGDARAIVKENIALKRSIGSYEGMRHALGLPVRGQRTRNNAKVARRLNKVDRR 120 EL+ MTIEGDARAIVK+NIALKR IGSY GMRH L LPVRGQ TRNNAK AR+LNK+DRR Sbjct: 61 ELSTMTIEGDARAIVKDNIALKRKIGSYSGMRHTLHLPVRGQHTRNNAKTARKLNKIDRR 120 Query: 121 GYHTQTRSPI 130 G HT +++ + Sbjct: 121 GIHTFSQAKV 130 >SPCC1795.07 [J] KOG3311 Ribosomal protein S18 Length = 151 Score = 102 bits (253), Expect = 2e-22 Identities = 52/101 (51%), Positives = 67/101 (65%) Query: 24 FYGIGLKTAEKICSKLGFYPWMRMHQLTEPQVMAITSELANMTIEGDARAIVKENIALKR 83 FYGIG AE+IC+KL F+ +R+ +LT Q+ ++ L+ MTIEGD R +I+ Sbjct: 22 FYGIGHAKAEEICAKLSFHNTLRVRELTNVQLTTLSQLLSGMTIEGDLRRQRNADISRLV 81 Query: 84 SIGSYEGMRHALGLPVRGQRTRNNAKVARRLNKVDRRGYHT 124 +I Y GMRH GLPV GQ TR NAK A++LNKV RRGY T Sbjct: 82 NIRCYRGMRHVNGLPVNGQNTRTNAKTAKKLNKVPRRGYMT 122 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.321 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,236,380 Number of Sequences: 60738 Number of extensions: 200584 Number of successful extensions: 469 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 467 Number of HSP's gapped (non-prelim): 2 length of query: 137 length of database: 30,389,216 effective HSP length: 95 effective length of query: 42 effective length of database: 24,619,106 effective search space: 1034002452 effective search space used: 1034002452 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits)