ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII2888 good I KOG3006 Lipid transport and metabolism Transthyretin and related proteins

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII2888 1017212 1016778 -145 
         (145 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value SPCC285.04 [I] KOG3006 Transthyretin and related proteins 88 3e-18 CE12662 [I] KOG3006 Transthyretin and related proteins 76 2e-14 CE18458 [I] KOG3006 Transthyretin and related proteins 72 3e-13 At5g58220 [I] KOG3006 Transthyretin and related proteins 62 3e-10 >SPCC285.04 [I] KOG3006 Transthyretin and related proteins Length = 124 Score = 88.2 bits (217), Expect = 3e-18 Identities = 51/141 (36%), Positives = 72/141 (50%), Gaps = 29/141 (20%) Query: 5 LTCHILDTVSGKPAESVVCTLSHLTLNSDNDTAIIESESQFAIAKTNADGRVTQWIFKPD 64 LT HIL+T+SG PA V L L + + S+ A +TNA+GRVT W Sbjct: 13 LTAHILNTMSGIPAAGVQVALFKL------NESPTPSQQFIATTETNANGRVTSW----- 61 Query: 65 PSERSHLKELGVVETSTGKLEWQSLKPGTYKIRFHTGNYFKQKKEPSFFPFVDIVFEVSD 124 ++ +++ G Y RF TG YF SF+P+V++ ++ Sbjct: 62 ------------------NVDLSTVESGIYTFRFETGAYFDSLGVTSFYPYVEMAVRINK 103 Query: 125 TRHYHIPLLLSNYGYSTYRGS 145 +HYHIPLLL+ YGY+TYRGS Sbjct: 104 GQHYHIPLLLAPYGYTTYRGS 124 >CE12662 [I] KOG3006 Transthyretin and related proteins Length = 121 Score = 75.9 bits (185), Expect = 2e-14 Identities = 35/69 (50%), Positives = 50/69 (71%), Gaps = 5/69 (7%) Query: 82 GKLEWQS----LKPGTYKIRFHTGNYFKQKKEPSFFPFVDIVFEVSD-TRHYHIPLLLSN 136 G+++W S L PGTY++ + T Y+K K SF+P+V++VF + D T+HYH+PL LS Sbjct: 53 GRVDWVSPDFTLIPGTYRLVYITEPYYKAKNVESFYPYVEVVFNIRDATQHYHVPLTLSP 112 Query: 137 YGYSTYRGS 145 +GYSTYRGS Sbjct: 113 WGYSTYRGS 121 >CE18458 [I] KOG3006 Transthyretin and related proteins Length = 190 Score = 71.6 bits (174), Expect = 3e-13 Identities = 33/69 (47%), Positives = 49/69 (70%), Gaps = 5/69 (7%) Query: 82 GKLEWQS----LKPGTYKIRFHTGNYFKQKKEPSFFPFVDIVFEVSD-TRHYHIPLLLSN 136 G+++W S L PGTY++ + T Y+ K SF+P+V++VF + + T+HYH+PL LS Sbjct: 122 GRVDWVSPDFTLIPGTYRLVYITEPYYTAKNVESFYPYVEVVFNIRNATQHYHVPLTLSP 181 Query: 137 YGYSTYRGS 145 +GYSTYRGS Sbjct: 182 WGYSTYRGS 190 >At5g58220 [I] KOG3006 Transthyretin and related proteins Length = 324 Score = 62.0 bits (149), Expect = 3e-10 Identities = 45/149 (30%), Positives = 66/149 (44%), Gaps = 36/149 (24%) Query: 4 PLTCHILDTVSGKPAESVVCTLSHLTLNSDNDTAIIESE----SQFAIAKTNADGRVTQW 59 P+T H+LD G PA V L + + + S + T+ DGR Sbjct: 205 PITTHVLDVSRGAPAAGVEVHLE--VWSGTTGPSFVHGGGGVWSSVGTSATDRDGRSGPL 262 Query: 60 IFKPDPSERSHLKELGVVETSTGKLEWQSLKPGTYKIRFHTGNYFKQKKEPSFFPFVDIV 119 + D +L PGTY+I F T Y FFP+V IV Sbjct: 263 MDLVD-----------------------ALNPGTYRISFDTAKY----SPGCFFPYVSIV 295 Query: 120 FEVSDTR---HYHIPLLLSNYGYSTYRGS 145 F+V++++ H+H+PLLL+ + +STYRGS Sbjct: 296 FQVTESQKWEHFHVPLLLAPFSFSTYRGS 324 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.317 0.133 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,772,181 Number of Sequences: 60738 Number of extensions: 399906 Number of successful extensions: 877 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 869 Number of HSP's gapped (non-prelim): 5 length of query: 145 length of database: 30,389,216 effective HSP length: 96 effective length of query: 49 effective length of database: 24,558,368 effective search space: 1203360032 effective search space used: 1203360032 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)