ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII2924 suspect: LH U KOG3498 Intracellular trafficking, secretion, and vesicular transport Preprotein translocase, gamma subunit

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII2924 1027661 1027452 -70  
         (70 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YDR086c [U] KOG3498 Preprotein translocase gamma subunit 70 5e-13 SPAC4G8.02c [U] KOG3498 Preprotein translocase gamma subunit 47 4e-06 >YDR086c [U] KOG3498 Preprotein translocase gamma subunit Length = 80 Score = 70.1 bits (170), Expect = 5e-13 Identities = 35/68 (51%), Positives = 40/68 (58%) Query: 3 KQNAQFDKLVETPLEFVKEGNQFLQKCKKPSKKEYLKXXXXXXXXXXXXXXXXXXXKLIH 62 + N Q +KLVE P+EFV+EG QFL KCKKP KEY K KLIH Sbjct: 13 QSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKIVKAVGIGFIAVGIIGYAIKLIH 72 Query: 63 IPIRYLIV 70 IPIRY+IV Sbjct: 73 IPIRYVIV 80 >SPAC4G8.02c [U] KOG3498 Preprotein translocase gamma subunit Length = 70 Score = 47.4 bits (111), Expect = 4e-06 Identities = 22/62 (35%), Positives = 31/62 (49%) Query: 9 DKLVETPLEFVKEGNQFLQKCKKPSKKEYLKXXXXXXXXXXXXXXXXXXXKLIHIPIRYL 68 D L + P F KEG+ F+++C KP +KE+L KLIHIPI + Sbjct: 6 DDLFQIPKNFYKEGSHFIKRCVKPDRKEFLSISKAVATGFVLMGLIGYIIKLIHIPINKV 65 Query: 69 IV 70 +V Sbjct: 66 LV 67 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.321 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,097,209 Number of Sequences: 60738 Number of extensions: 73007 Number of successful extensions: 155 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 152 Number of HSP's gapped (non-prelim): 2 length of query: 70 length of database: 30,389,216 effective HSP length: 46 effective length of query: 24 effective length of database: 27,595,268 effective search space: 662286432 effective search space used: 662286432 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)