ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII3192 suspect: LH T KOG3589 Signal transduction mechanisms G protein signaling regulators

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII3192 1124930 1123920 -337 
         (337 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YOR107w [T] KOG3589 G protein signaling regulators 73 5e-13 >YOR107w [T] KOG3589 G protein signaling regulators Length = 309 Score = 73.2 bits (178), Expect = 5e-13 Identities = 45/152 (29%), Positives = 71/152 (46%), Gaps = 17/152 (11%) Query: 16 HHDEILSG-----FHDFLAKPHCDENLWFIKATNPFMNPNSKLSFTH------WN-DVYR 63 HH+ + S F+ FL + HC+ENL F + + F+ S + WN +Y Sbjct: 38 HHERMRSPYTIQKFYKFLKRAHCEENLEFFEKAHQFLQLKQNRSISEEKLLEVWNKSLYI 97 Query: 64 RFIQEDAPKECNFPESIRICFDEAFRKHGLPTHETIEQARLHIVNLLQDAYSKFQRNSDI 123 ++I D+PKECNF + R F++ F + +P + A H++ LL D Y +F + Sbjct: 98 KYIAVDSPKECNFSQDTREIFEKCFANNEVPADVDVLCAISHVMGLLMDGYHRFVSS--- 154 Query: 124 PDNIKYTDCYCHKDGTLYHHSDTDKDQNTSHS 155 + KY+ Y H D D + TS S Sbjct: 155 VNEKKYSATYAHNDSAT--EQDLKNESTTSFS 184 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.320 0.136 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,227,064 Number of Sequences: 60738 Number of extensions: 539055 Number of successful extensions: 1179 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1178 Number of HSP's gapped (non-prelim): 1 length of query: 337 length of database: 30,389,216 effective HSP length: 107 effective length of query: 230 effective length of database: 23,890,250 effective search space: 5494757500 effective search space used: 5494757500 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)