ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII3692 suspect: LH J KOG4778 Translation, ribosomal structure and biogenesis Mitochondrial ribosomal protein L28

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII3692 1301197  1301637 147  
         (147 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YDR462w [J] KOG4778 Mitochondrial ribosomal protein L28 174 4e-44 SPAC4F8.05c [J] KOG4778 Mitochondrial ribosomal protein L28 53 2e-07 >YDR462w [J] KOG4778 Mitochondrial ribosomal protein L28 Length = 147 Score = 174 bits (441), Expect = 4e-44 Identities = 79/134 (58%), Positives = 108/134 (79%) Query: 12 LKVVQPSLNFVRGKRTKSKGGLNPQAQRIITQLSVMSASRKQPKLLKLSREDLIKHDMIQ 71 L+ V + F+R KRTKSK L+P AQR++TQLSVMSASRKQPKLLKL+REDLIKH I+ Sbjct: 14 LEQVSGTTVFIRNKRTKSKSSLSPLAQRVVTQLSVMSASRKQPKLLKLAREDLIKHQTIE 73 Query: 72 ACWAQYQRELREKRTNLLKLQYENIEEAMNLLEQVDPELYEMANAEESGKRVPLELRVPT 131 CW+ YQ++ RE+R L+LQY++IE +MNLL+++ P L+E ANA E GKR P+E++VPT Sbjct: 74 KCWSIYQQQQRERRNLQLELQYKSIERSMNLLQELSPRLFEAANASEKGKRFPMEMKVPT 133 Query: 132 QYPPNNVWYYDYKK 145 +PPN +W+Y+++K Sbjct: 134 DFPPNTLWHYNFRK 147 >SPAC4F8.05c [J] KOG4778 Mitochondrial ribosomal protein L28 Length = 118 Score = 52.8 bits (125), Expect = 2e-07 Identities = 26/84 (30%), Positives = 46/84 (53%) Query: 52 KQPKLLKLSREDLIKHDMIQACWAQYQRELREKRTNLLKLQYENIEEAMNLLEQVDPELY 111 K+ + LK++ + KH++I W ++ ++R NLLK Q+ ++ A L+ LY Sbjct: 31 KKVRSLKMNPDMWEKHEVINRAWRIHEYRQEKQRENLLKNQFSAMKIACEELKHTSETLY 90 Query: 112 EMANAEESGKRVPLELRVPTQYPP 135 + A ++ +R P+E R PT PP Sbjct: 91 KAAMSDSINRRFPVETRTPTDTPP 114 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.314 0.130 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,390,495 Number of Sequences: 60738 Number of extensions: 314283 Number of successful extensions: 999 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 997 Number of HSP's gapped (non-prelim): 2 length of query: 147 length of database: 30,389,216 effective HSP length: 96 effective length of query: 51 effective length of database: 24,558,368 effective search space: 1252476768 effective search space used: 1252476768 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)