ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII4229 suspect: LH R KOG0017 General function prediction only FOG: Transposon-encoded proteins with TYA, reverse transcriptase, integrase domains in various combinations

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII4229 1490472  1493336 955  
         (955 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YLR256w [R] KOG0017 FOG: Transposon-encoded proteins with TYA re... 53 3e-06 >YLR256w [R] KOG0017 FOG: Transposon-encoded proteins with TYA reverse transcriptase integrase domains in various combinations Length = 1502 Score = 52.8 bits (125), Expect = 3e-06 Identities = 35/91 (38%), Positives = 42/91 (45%), Gaps = 24/91 (26%) Query: 34 KIQHKRQRQILSCVACHKRKIKCDRAKPVCESCGKNGWE--CLYFLNARVSRGGKHNIST 91 KI+ KR R LSC C KRK+KCD+ +P C+ C K G C Y Sbjct: 52 KIKRKRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYM--------------- 96 Query: 92 GTEDVTASEASKE-----ELLKVIEKAKVLE 117 E A EA KE EL K+ E+ K LE Sbjct: 97 --EQTWAEEAEKELLKDNELKKLRERVKSLE 125 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,493,868 Number of Sequences: 60738 Number of extensions: 2235596 Number of successful extensions: 6192 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6192 Number of HSP's gapped (non-prelim): 1 length of query: 955 length of database: 30,389,216 effective HSP length: 116 effective length of query: 839 effective length of database: 23,343,608 effective search space: 19585287112 effective search space used: 19585287112 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)