ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII4342 suspect: LH C KOG4103 Energy production and conversion Mitochondrial F1F0-ATP synthase, subunit g/ATP20

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII4342 1532337 1531981 -119 
         (119 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YPR020w [C] KOG4103 Mitochondrial F1F0-ATP synthase subunit g/ATP20 140 4e-34 >YPR020w [C] KOG4103 Mitochondrial F1F0-ATP synthase subunit g/ATP20 Length = 115 Score = 140 bits (352), Expect = 4e-34 Identities = 63/115 (54%), Positives = 91/115 (78%) Query: 1 MISRVQSLVSSLTHKTQSLLTKTVYYGKVTAELSKQVYTKEGLQPPNFSDFEMVYTRLYR 60 M+SR+Q+ S L K L +K +YYGKV AE+SKQ+Y KEGLQPP + F+ VY+ LY+ Sbjct: 1 MLSRIQNYTSGLVSKANLLSSKALYYGKVGAEISKQIYLKEGLQPPTVAQFKSVYSNLYK 60 Query: 61 QALGYADKPQQVVNLLKNIEKDQAVKIGAFGVQLLGLYSLGEIIGRRKVVGYRNY 115 Q+L +A KP +V++ LKNI+K++ +K GA+G+QL+G YS+GEIIGRRK+VGY+++ Sbjct: 61 QSLNFALKPTEVLSCLKNIQKNELLKYGAYGIQLIGFYSVGEIIGRRKLVGYKHH 115 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.318 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,280,135 Number of Sequences: 60738 Number of extensions: 221362 Number of successful extensions: 536 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 535 Number of HSP's gapped (non-prelim): 1 length of query: 119 length of database: 30,389,216 effective HSP length: 95 effective length of query: 24 effective length of database: 24,619,106 effective search space: 590858544 effective search space used: 590858544 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)