ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIII4567 suspect: LH R KOG3669 General function prediction only Uncharacterized conserved protein, contains dysferlin, TECPR and PH domains

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIII4567 1612956 1611379 -526 
         (526 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value 7293668 [R] KOG3669 Uncharacterized conserved protein contains d... 52 2e-06 >7293668 [R] KOG3669 Uncharacterized conserved protein contains dysferlin TECPR and PH domains Length = 823 Score = 52.4 bits (124), Expect = 2e-06 Identities = 37/121 (30%), Positives = 59/121 (48%), Gaps = 20/121 (16%) Query: 280 PIRFTYVLYENQRRWLGI-GWTANMLTYERSSWTDEFLNEAPSPEQFKLPEEASGMAWRW 338 PIR YEN+R WL I G++ +L +R ++ + ++ +LP MAW+W Sbjct: 64 PIRIREESYENER-WLPIEGFSKTLLPTDRYRYSSADGSVERGVDKIRLPS----MAWQW 118 Query: 339 VDKTWRLDMTNDGAIQLSSTRPKTTASPGADDGFIYYDNTWKKPSTEDSFSKYTRRRRWI 398 D W LD+ DG P +DG++Y + S + S++ Y RRR+W+ Sbjct: 119 -DGDWHLDLELDG-------------QPLTEDGWMYALDFPATYSAKKSWNSYVRRRKWV 164 Query: 399 R 399 R Sbjct: 165 R 165 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.314 0.131 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,445,911 Number of Sequences: 60738 Number of extensions: 1442297 Number of successful extensions: 6689 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6689 Number of HSP's gapped (non-prelim): 1 length of query: 526 length of database: 30,389,216 effective HSP length: 111 effective length of query: 415 effective length of database: 23,647,298 effective search space: 9813628670 effective search space used: 9813628670 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)