ORF STATUS Function Best COG Functional category Pathways and functional systems
r_klactIV0044.1 suspect: LH P KOG4480 Inorganic ion transport and metabolism Heme oxygenase
Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= r_klactIV0044.1 11417 11629 71
(71 letters)
Database: KOG eukaryal database 04/03
60,738 sequences; 30,389,216 total letters
Searching..................................................done
Color Key for Alignment Scores:
Score E
Sequences producing significant alignments: (bits) Value
Hs4504437 [P] KOG4480 Heme oxygenase 27 6.7
>Hs4504437 [P] KOG4480 Heme oxygenase
Length = 288
Score = 26.6 bits (57), Expect = 6.7
Identities = 13/41 (31%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
Query: 10 PNRVSS-KFFNVLQLRINTFDITPSIMVRVFETSRVNLVNN 49
PN S+ KF + + R+N+ ++TP++ RV E ++ + N
Sbjct: 170 PNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLN 210
Database: KOG eukaryal database 04/03
Posted date: Apr 14, 2003 1:07 PM
Number of letters in database: 30,389,216
Number of sequences in database: 60,738
Lambda K H
0.330 0.144 0.487
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,468,756
Number of Sequences: 60738
Number of extensions: 131628
Number of successful extensions: 274
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 273
Number of HSP's gapped (non-prelim): 1
length of query: 71
length of database: 30,389,216
effective HSP length: 47
effective length of query: 24
effective length of database: 27,534,530
effective search space: 660828720
effective search space used: 660828720
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)