ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV0044.1   suspect: LH  P     KOG4480   Inorganic ion transport and metabolism                         Heme oxygenase

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV0044.1 11417  11629 71   
         (71 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Hs4504437 [P] KOG4480 Heme oxygenase                                   27   6.7  

>Hs4504437 [P] KOG4480 Heme oxygenase
          Length = 288

 Score = 26.6 bits (57), Expect = 6.7
 Identities = 13/41 (31%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 10  PNRVSS-KFFNVLQLRINTFDITPSIMVRVFETSRVNLVNN 49
           PN  S+ KF  + + R+N+ ++TP++  RV E ++   + N
Sbjct: 170 PNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLN 210


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.330    0.144    0.487 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,468,756
Number of Sequences: 60738
Number of extensions: 131628
Number of successful extensions: 274
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 273
Number of HSP's gapped (non-prelim): 1
length of query: 71
length of database: 30,389,216
effective HSP length: 47
effective length of query: 24
effective length of database: 27,534,530
effective search space: 660828720
effective search space used: 660828720
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)