ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV0228   suspect: LH   C     KOG3495  Energy production and conversion                               Mitochondrial F1F0-ATP synthase, subunit epsilon/ATP15

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV0228  72937 72755 -61  
         (61 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPL271w [C] KOG3495 Mitochondrial F1F0-ATP synthase subunit epsi...    67   5e-12

>YPL271w [C] KOG3495 Mitochondrial F1F0-ATP synthase subunit epsilon/ATP15
          Length = 62

 Score = 67.0 bits (162), Expect = 5e-12
 Identities = 32/62 (51%), Positives = 48/62 (76%), Gaps = 1/62 (1%)

Query: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENG-VASEPVPL 59
          MS WRKAG+++  Y++VAA  +R++LK ELQT SVL RS+++A + +++NG  ASEP P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI 60

Query: 60 KK 61
           K
Sbjct: 61 TK 62


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.311    0.123    0.336 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,050,623
Number of Sequences: 60738
Number of extensions: 71922
Number of successful extensions: 142
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 141
Number of HSP's gapped (non-prelim): 1
length of query: 61
length of database: 30,389,216
effective HSP length: 37
effective length of query: 24
effective length of database: 28,141,910
effective search space: 675405840
effective search space used: 675405840
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)