ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV0687 suspect: LH U KOG4072 Intracellular trafficking, secretion, and vesicular transport Signal peptidase complex, subunit SPC25

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV0687  217940  218446 169  
         (169 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value CE20214 [U] KOG4072 Signal peptidase complex subunit SPC25 50 1e-06 >CE20214 [U] KOG4072 Signal peptidase complex subunit SPC25 Length = 180 Score = 50.4 bits (119), Expect = 1e-06 Identities = 35/134 (26%), Positives = 70/134 (52%), Gaps = 6/134 (4%) Query: 3 KPINVYAVPEVRKALDEALPEIFS-RLGYTQTFKLIDTKLILGYSLVVFAAASFLLDKKL 61 K +N + P V+ ALDE + +I + ++G+T++ L++ +L++ + V F+A + D Sbjct: 7 KVVNKWDGPTVKNALDEVVKKILNDKVGWTESHNLMNLRLLISFIGVAFSAFACGYDYYE 66 Query: 62 PWEQSKPYQQVLVALYMILSAVQLWFNKFVEKGTVYQGV----KKNDTVSVGAKYKKHSH 117 P+ +SK V Y I + + +VEK +Y+ K++ + ++ K H Sbjct: 67 PFPKSKIVLAVCSVSYFICMGILQMYQWYVEKDCIYEATEVDGKQSRKWAWSSEIKAHDD 126 Query: 118 EFHVSITNRK-GRS 130 ++ +S +K GRS Sbjct: 127 KYTLSAEFKKEGRS 140 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.320 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,460,236 Number of Sequences: 60738 Number of extensions: 358383 Number of successful extensions: 919 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 919 Number of HSP's gapped (non-prelim): 1 length of query: 169 length of database: 30,389,216 effective HSP length: 99 effective length of query: 70 effective length of database: 24,376,154 effective search space: 1706330780 effective search space used: 1706330780 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)