ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV0755 suspect: LH R KOG3037 General function prediction only Cell membrane glycoprotein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV0755  246326  246943 206  
         (206 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YLR421c [R] KOG3037 Cell membrane glycoprotein 134 1e-31 >YLR421c [R] KOG3037 Cell membrane glycoprotein Length = 156 Score = 134 bits (336), Expect = 1e-31 Identities = 59/108 (54%), Positives = 84/108 (77%), Gaps = 1/108 (0%) Query: 46 ISFRAGKCDYDEESKICTPKQMKGEIQIKPSEEAQ-GFFDFQWSTKDRVSGSAVEPIEFI 104 I FRAG C+Y+E+S++CTP ++GEI+IKP+EE + GF+DF+W ++ G ++PI I Sbjct: 8 IKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLI 67 Query: 105 LIPGETKWIDIKSAKNGRVLCLLFSTGEKWFFWLQEKHQGNESLNEWS 152 LIPGET W+ IKS+K+GR+ L+FS+ E++FFWLQEK+ GN LNE S Sbjct: 68 LIPGETMWVPIKSSKSGRIFALVFSSNERYFFWLQEKNSGNLPLNELS 115 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.315 0.132 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,213,686 Number of Sequences: 60738 Number of extensions: 412587 Number of successful extensions: 853 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 851 Number of HSP's gapped (non-prelim): 1 length of query: 206 length of database: 30,389,216 effective HSP length: 101 effective length of query: 105 effective length of database: 24,254,678 effective search space: 2546741190 effective search space used: 2546741190 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)